SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1glfx2 (1glf X:254-500)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2122736Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 2122737Protein Glycerol kinase [53090] (2 species)
  7. 2122779Species Escherichia coli [TaxId:562] [53091] (14 PDB entries)
  8. 2122821Domain d1glfx2: 1glf X:254-500 [33512]
    complexed with adp, gol, po4; mutant

Details for d1glfx2

PDB Entry: 1glf (more details), 2.62 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation
PDB Compounds: (X:) protein (glycerol kinase)

SCOPe Domain Sequences for d1glfx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glfx2 c.55.1.4 (X:254-500) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweehd

SCOPe Domain Coordinates for d1glfx2:

Click to download the PDB-style file with coordinates for d1glfx2.
(The format of our PDB-style files is described here.)

Timeline for d1glfx2: