Lineage for d1glfo2 (1glf O:254-499)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 71789Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 71950Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 71951Protein Glycerol kinase [53090] (1 species)
  7. 71952Species Escherichia coli [TaxId:562] [53091] (12 PDB entries)
  8. 71964Domain d1glfo2: 1glf O:254-499 [33510]

Details for d1glfo2

PDB Entry: 1glf (more details), 2.62 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation

SCOP Domain Sequences for d1glfo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glfo2 c.55.1.4 (O:254-499) Glycerol kinase {Escherichia coli}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

SCOP Domain Coordinates for d1glfo2:

Click to download the PDB-style file with coordinates for d1glfo2.
(The format of our PDB-style files is described here.)

Timeline for d1glfo2: