SCOPe 2.06: Domain d5u9mc_: 5u9m C:

Lineage for d5u9mc_ (5u9m C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (79 PDB entries)

8. Domain d5u9mc_: 5u9m C: [334942]
   Other proteins in same PDB: d5u9mb1, d5u9mb2, d5u9md1, d5u9md2
   automated match to d3k91a_
   complexed with zn

Details for d5u9mc_

PDB Entry: 5u9m, 2.35 Å

PDB Description: copper-zinc superoxide dismutase is activated through a sulfenic acid intermediate at a copper-ion entry site

PDB Compounds: (C:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d5u9mc_:

Sequence; same for both SEQRES and ATOM records:

>d5u9mc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Timeline for d5u9mc_:

• d5u9mc_ is new in SCOPe 2.06-stable
  
• d5u9mc_ appears in SCOPe 2.07
  
• d5u9mc_ appears in the current release, SCOPe 2.08