Lineage for d5u9mc_ (5u9m C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2360693Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2360694Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2360707Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2360810Species Human (Homo sapiens) [TaxId:9606] [49333] (81 PDB entries)
  8. 2361108Domain d5u9mc_: 5u9m C: [334942]
    Other proteins in same PDB: d5u9mb1, d5u9mb2, d5u9md1, d5u9md2
    automated match to d3k91a_
    complexed with zn

Details for d5u9mc_

PDB Entry: 5u9m (more details), 2.35 Å

PDB Description: copper-zinc superoxide dismutase is activated through a sulfenic acid intermediate at a copper-ion entry site
PDB Compounds: (C:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d5u9mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u9mc_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d5u9mc_:

Click to download the PDB-style file with coordinates for d5u9mc_.
(The format of our PDB-style files is described here.)

Timeline for d5u9mc_: