Lineage for d1dgkn4 (1dgk N:671-913)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884234Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 2884256Protein Mammalian type I hexokinase [53086] (2 species)
    further duplication: consists of two very similar lobes
  7. 2884257Species Human (Homo sapiens) [TaxId:9606] [53087] (10 PDB entries)
  8. 2884305Domain d1dgkn4: 1dgk N:671-913 [33490]
    complexed with adp, glc, po4; mutant

Details for d1dgkn4

PDB Entry: 1dgk (more details), 2.8 Å

PDB Description: mutant monomer of recombinant human hexokinase type i with glucose and adp in the active site
PDB Compounds: (N:) hexokinase type I

SCOPe Domain Sequences for d1dgkn4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgkn4 c.55.1.3 (N:671-913) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]}
tcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvd
eyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqi
esdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrg
ldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvr
lrt

SCOPe Domain Coordinates for d1dgkn4:

Click to download the PDB-style file with coordinates for d1dgkn4.
(The format of our PDB-style files is described here.)

Timeline for d1dgkn4: