PDB entry 1dgk

View 1dgk on RCSB PDB site
Description: mutant monomer of recombinant human hexokinase type I with glucose and ADP in the active site
Class: transferase
Keywords: brain hexokinase, mammalian hexokinase 1, sugar kinase, transferase
Deposited on 1999-11-24, released 2000-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.26
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'N':
    Compound: hexokinase type I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19367
      • engineered (239)
      • engineered (242)
      • engineered (283)
      • engineered (535)
      • conflict (729)
      • conflict (775)
    Domains in SCOPe 2.07: d1dgkn1, d1dgkn2, d1dgkn3, d1dgkn4
  • Heterogens: GLC, PO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1dgkN (N:)
    miaaqllayyftelkddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptat
    vkmlptfvrsipdgsekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivh
    gsgsqlfdhvaeclgdfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgv
    egadvvkllnkaikkrgdydanivavvndtvgtmmtcgyddqhcevgliigtgtnacyme
    elrhidlvegdegrmcintewgafgddgsledirtefdraidayslnpgkqlfekmvsgm
    ylgelvrlilvkmakegllfegritpelltrgkfntsdvsaieknkeglhnakeiltrlg
    vepsdddcvsvqhvctivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykth
    pqysrrfhktlrrlvpdsdvrfllsesgsgkgaamvtavayrlaeqhrqieetlahfhlt
    kdmllevkkrmraemelglrkqthnnavvkmlpsfvrrtpdgtengdflaldlgganfrv
    llvkirsgkkrtvemhnkiyaipieimqgtgeelfdhivscisdfldymgikgprmplgf
    tfsfpcqqtsldagilitwtkgfkatdcvghdvvtllrdaikrreefdldvvavvndtvg
    tmmtcayeeptcevglivgtgsnacymeemknvemvegdqgqmcinmewgafgdngcldd
    irthydrlvdeyslnagkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrg
    ifetkflsqiesdrlallqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaa
    vvdkirenrgldrlnvtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkg
    aalitavgvrlrteass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dgkN (N:)
    ddqvkkidkylyamrlsdetlidimtrfrkemknglsrdfnptatvkmlptfvrsipdgs
    ekgdfialdlggssfrilrvqvnheknqnvhmesevydtpenivhgsgsqlfdhvaeclg
    dfmekrkikdkklpvgftfsfpcqqskideailitwtkrfkasgvegadvvkllnkaikk
    rgdydanivavvndtvgtmmtcgyddqhcevgliigtgtnacymeelrhidlvegdegrm
    cintewgafgddgsledirtefdraidayslnpgkqlfekmvsgmylgelvrlilvkmak
    egllfegritpelltrgkfntsdvsaieknkeglhnakeiltrlgvepsdddcvsvqhvc
    tivsfrsanlvaatlgailnrlrdnkgtprlrttvgvdgslykthpqysrrfhktlrrlv
    pdsdvrfllsesgsgkgaamvtavayrlaeqhrqieetlahfhltkdmllevkkrmraem
    elglrkqthnnavvkmlpsfvrrtpdgtengdflaldlgganfrvllvkirsgkkrtvem
    hnkiyaipieimqgtgeelfdhivscisdfldymgikgprmplgftfsfpcqqtsldagi
    litwtkgfkatdcvghdvvtllrdaikrreefdldvvavvndtvgtmmtcayeeptcevg
    livgtgsnacymeemknvemvegdqgqmcinmewgafgdngclddirthydrlvdeysln
    agkqryekmisgmylgeivrnilidftkkgflfrgqisetlktrgifetkflsqiesdrl
    allqvrailqqlglnstcddsilvktvcgvvsrraaqlcgagmaavvdkirenrgldrln
    vtvgvdgtlyklhphfsrimhqtvkelspkcnvsfllsedgsgkgaalitavgvrlrt