SCOPe 2.08: Domain d5umnd2: 5umn D:107-213

Lineage for d5umnd2 (5umn D:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5umnd2: 5umn D:107-213 [334802]
   Other proteins in same PDB: d5umna_, d5umnb_, d5umnc1, d5umnc2, d5umnd1, d5umne1, d5umne2, d5umnf1
   automated match to d1dn0a2
   complexed with 1pe, flc, na, nag; mutant

Details for d5umnd2

PDB Entry: 5umn, 1.97 Å

PDB Description: crystal structure of c05 vpgsgw mutant bound to h3 influenza hemagglutinin, ha1 subunit

PDB Compounds: (D:) Antibody C05, Light Chain

SCOPe Domain Sequences for d5umnd2:

Sequence; same for both SEQRES and ATOM records:

>d5umnd2 b.1.1.2 (D:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5umnd2:

• d5umnd2 first appeared in SCOPe 2.06
  
• d5umnd2 appears in SCOPe 2.07