Lineage for d5umnf1 (5umn F:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754897Domain d5umnf1: 5umn F:1-106 [334630]
    Other proteins in same PDB: d5umna_, d5umnb_, d5umnc1, d5umnc2, d5umnd2, d5umne1, d5umne2, d5umnf2
    automated match to d1dn0a1
    complexed with 1pe, flc, na, nag; mutant

Details for d5umnf1

PDB Entry: 5umn (more details), 1.97 Å

PDB Description: crystal structure of c05 vpgsgw mutant bound to h3 influenza hemagglutinin, ha1 subunit
PDB Compounds: (F:) Antibody C05, Light Chain

SCOPe Domain Sequences for d5umnf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5umnf1 b.1.1.0 (F:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvi

SCOPe Domain Coordinates for d5umnf1:

Click to download the PDB-style file with coordinates for d5umnf1.
(The format of our PDB-style files is described here.)

Timeline for d5umnf1: