SCOPe 2.06: Domain d5tznw_: 5tzn W:

Lineage for d5tznw_ (5tzn W:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (21 PDB entries)

8. Domain d5tznw_: 5tzn W: [334742]
   Other proteins in same PDB: d5tzna2
   automated match to d1yxja_
   complexed with bma, fuc, iod, nag

Details for d5tznw_

PDB Entry: 5tzn, 2.6 Å

PDB Description: structure of the viral immunoevasin m12 (smith) bound to the natural killer cell receptor nkr-p1b (b6)

PDB Compounds: (W:) Killer cell lectin-like receptor subfamily B member 1B allele B

SCOPe Domain Sequences for d5tznw_:

Sequence, based on SEQRES records:

>d5tznw_ d.169.1.0 (W:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekynsfw
iglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdnrwicqke
ln

Sequence, based on observed residues (ATOM records):

>d5tznw_ d.169.1.0 (W:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsiekynsfwi
glsytltdmnwkwingtafnsvlkitgvtengscaaisgekvtsegcssdnrwicqkeln

Timeline for d5tznw_:

• d5tznw_ is new in SCOPe 2.06-stable
  
• d5tznw_ appears in SCOPe 2.07
  
• d5tznw_ appears in the current release, SCOPe 2.08