Lineage for d5tznw_ (5tzn W:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 2559977Species Mouse (Mus musculus) [TaxId:10090] [187331] (27 PDB entries)
  8. 2560020Domain d5tznw_: 5tzn W: [334742]
    Other proteins in same PDB: d5tzna2
    automated match to d1yxja_
    complexed with bma, fuc, iod, nag

Details for d5tznw_

PDB Entry: 5tzn (more details), 2.6 Å

PDB Description: structure of the viral immunoevasin m12 (smith) bound to the natural killer cell receptor nkr-p1b (b6)
PDB Compounds: (W:) Killer cell lectin-like receptor subfamily B member 1B allele B

SCOPe Domain Sequences for d5tznw_:

Sequence, based on SEQRES records: (download)

>d5tznw_ d.169.1.0 (W:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsikekynsfw
iglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdnrwicqke
ln

Sequence, based on observed residues (ATOM records): (download)

>d5tznw_ d.169.1.0 (W:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsiekynsfwi
glsytltdmnwkwingtafnsvlkitgvtengscaaisgekvtsegcssdnrwicqkeln

SCOPe Domain Coordinates for d5tznw_:

Click to download the PDB-style file with coordinates for d5tznw_.
(The format of our PDB-style files is described here.)

Timeline for d5tznw_: