SCOPe 2.01: Domain d1deja2: 1dej A:147-375

Lineage for d1deja2 (1dej A:147-375)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [53076] (6 PDB entries)

8. Domain d1deja2: 1dej A:147-375 [33446]
   Other proteins in same PDB: d1dejs_
   dictyostelium/tetrahymena chimera
   complexed with atp, ca; mutant

Details for d1deja2

PDB Entry: 1dej, 2.4 Å

PDB Description: crystal structure of a dictyostelium/tetrahymena chimera actin (mutant 646: q228k/t229a/a230y/a231k/s232e/e360h) in complex with human gelsolin segment 1

PDB Compounds: (A:) chimeric actin

SCOPe Domain Sequences for d1deja2:

Sequence; same for both SEQRES and ATOM records:

>d1deja2 c.55.1.1 (A:147-375) Actin {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaer
eivrdikeklayvaldfeaemkaykessaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskheydesgpsivhrkcf

Timeline for d1deja2:

• d1deja2 first appeared (with stable ids) in SCOP 1.55
  
• d1deja2 appears in SCOP 1.75
  
• d1deja2 appears in SCOPe 2.02
  
• d1deja2 appears in the current release, SCOPe 2.08