Lineage for d5vl1b2 (5vl1 B:151-494)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2968016Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2968017Protein automated matches [226887] (24 species)
    not a true protein
  7. 2968130Species Mycobacterium ulcerans [TaxId:362242] [334394] (2 PDB entries)
  8. 2968136Domain d5vl1b2: 5vl1 B:151-494 [334395]
    Other proteins in same PDB: d5vl1a1, d5vl1b1, d5vl1c1, d5vl1d1
    automated match to d3bjua2
    protein/RNA complex; complexed with lys, peg, pge

Details for d5vl1b2

PDB Entry: 5vl1 (more details), 2.7 Å

PDB Description: crystal structure of lysyl-trna synthetase from mycobacterium ulcerans complexed with l-lysine
PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d5vl1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vl1b2 d.104.1.0 (B:151-494) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
kemseesrvrqryvdlivrpqarevarqriaviravrnalerrgflevetpmlqtlagga
aarpfvthsnaldidlylriapelflkrcivggfdrvfelnrvfrnegsdsthspefsml
etyqtygtyddsalitreliqevadeaigtrqlsmpdgsvydidgewatmemysslseal
geqitpettvarlrdiasgldveidnsvfghgklveelwehavgnkltaptfvkdfpvet
tpltrqhrsipgvtekwdlyvrgvelatgyselndpvvqrdrfadqaraaaagddeamql
dedfltaleygmppctgtgmgidrllmcltglsiretvlfpivr

SCOPe Domain Coordinates for d5vl1b2:

Click to download the PDB-style file with coordinates for d5vl1b2.
(The format of our PDB-style files is described here.)

Timeline for d5vl1b2: