Lineage for d5v6aa2 (5v6a A:1543-1800)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927545Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2927546Protein Papain-like protease PLpro, catalytic domain [310795] (4 species)
  7. 2927547Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311055] (7 PDB entries)
  8. 2927554Domain d5v6aa2: 5v6a A:1543-1800 [334340]
    Other proteins in same PDB: d5v6aa1, d5v6ab_
    automated match to d4pt5a2
    complexed with cl, flc, zn

Details for d5v6aa2

PDB Entry: 5v6a (more details), 2.7 Å

PDB Description: crystal structure of the middle east respiratory syndrome coronavirus papain-like protease bound to ubiquitin variant me.2
PDB Compounds: (A:) MERS-CoV PLpro

SCOPe Domain Sequences for d5v6aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v6aa2 d.3.1.23 (A:1543-1800) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyss

SCOPe Domain Coordinates for d5v6aa2:

Click to download the PDB-style file with coordinates for d5v6aa2.
(The format of our PDB-style files is described here.)

Timeline for d5v6aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5v6aa1
View in 3D
Domains from other chains:
(mouse over for more information)
d5v6ab_