Lineage for d5v6aa1 (5v6a A:1481-1542)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933397Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311415] (6 PDB entries)
  8. 2933403Domain d5v6aa1: 5v6a A:1481-1542 [334339]
    Other proteins in same PDB: d5v6aa2
    automated match to d4pt5a1
    complexed with cl, flc, zn

Details for d5v6aa1

PDB Entry: 5v6a (more details), 2.7 Å

PDB Description: crystal structure of the middle east respiratory syndrome coronavirus papain-like protease bound to ubiquitin variant me.2
PDB Compounds: (A:) MERS-CoV PLpro

SCOPe Domain Sequences for d5v6aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v6aa1 d.15.1.0 (A:1481-1542) automated matches {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
qqltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladn
lt

SCOPe Domain Coordinates for d5v6aa1:

Click to download the PDB-style file with coordinates for d5v6aa1.
(The format of our PDB-style files is described here.)

Timeline for d5v6aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5v6aa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5v6ab_