Lineage for d1hlua2 (1hlu A:147-375)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171252Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 1171253Protein Actin [53073] (6 species)
  7. 1171264Species Cow (Bos taurus) [TaxId:9913] [53074] (5 PDB entries)
  8. 1171280Domain d1hlua2: 1hlu A:147-375 [33432]
    Other proteins in same PDB: d1hlup_
    complexed with atp, ca

Details for d1hlua2

PDB Entry: 1hlu (more details), 2.65 Å

PDB Description: structure of bovine beta-actin-profilin complex with actin bound atp phosphates solvent accessible
PDB Compounds: (A:) beta-actin

SCOPe Domain Sequences for d1hlua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlua2 c.55.1.1 (A:147-375) Actin {Cow (Bos taurus) [TaxId: 9913]}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf

SCOPe Domain Coordinates for d1hlua2:

Click to download the PDB-style file with coordinates for d1hlua2.
(The format of our PDB-style files is described here.)

Timeline for d1hlua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hlua1
View in 3D
Domains from other chains:
(mouse over for more information)
d1hlup_