PDB entry 1hlu
View 1hlu on RCSB PDB site
Description: structure of bovine beta-actin-profilin complex with actin bound ATP phosphates solvent accessible
Class: complex (acetylation/actin-binding)
Keywords: complex (acetylation/actin-binding), actin, profilin, conformational changes, cytoskeleton
Deposited on
1997-05-30, released
1997-10-15
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.201
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: beta-actin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1hlua1, d1hlua2 - Chain 'P':
Compound: Profilin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1hlup_ - Heterogens: CA, ATP
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1hluA (A:)
dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasgrttgivmdsgdgvthtvpiyegyalphailrldla
grdltdylmkiltergysftttaereivrdikeklcyvaldfeqemataassssleksye
lpdgqvitignerfrcpealfqpsflgmescgihettfnsimkcdvdirkdlyantvlsg
gttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwiskqe
ydesgpsivhrkcf
- Chain 'P':
Sequence; same for both SEQRES and ATOM records: (download)
>1hluP (P:)
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy