Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) automatically mapped to Pfam PF00754 |
Protein B1 domain of neuropilin-1 [82016] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [82017] (9 PDB entries) |
Domain d5jgqb_: 5jgq B: [334120] Other proteins in same PDB: d5jgqa2 automated match to d1kexa_ complexed with 6jy, dms |
PDB Entry: 5jgq (more details), 1.6 Å
SCOPe Domain Sequences for d5jgqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jgqb_ b.18.1.2 (B:) B1 domain of neuropilin-1 {Human (Homo sapiens) [TaxId: 9606]} kcmealgmesgeihsdqitassqystnwsaersrlnypengwtpgedsyrewiqvdlgll rfvtavgtqgaisketkkkyyvktykidvssngedwitikegnkpvlfqgntnptdvvva vfpkplitrfvrikpatwetgismrfevygckit
Timeline for d5jgqb_: