Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (22 species) not a true protein |
Species SARS coronavirus [TaxId:227859] [311281] (4 PDB entries) |
Domain d5tl7d1: 5tl7 D:4-62 [333891] Other proteins in same PDB: d5tl7b2, d5tl7b3, d5tl7d2 automated match to d3e9sa1 complexed with zn |
PDB Entry: 5tl7 (more details), 2.44 Å
SCOPe Domain Sequences for d5tl7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tl7d1 d.15.1.0 (D:4-62) automated matches {SARS coronavirus [TaxId: 227859]} ktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlpsd
Timeline for d5tl7d1: