Lineage for d5tl7d1 (5tl7 D:4-62)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540633Species SARS coronavirus [TaxId:227859] [311281] (4 PDB entries)
  8. 2540637Domain d5tl7d1: 5tl7 D:4-62 [333891]
    Other proteins in same PDB: d5tl7b2, d5tl7b3, d5tl7d2
    automated match to d3e9sa1
    complexed with zn

Details for d5tl7d1

PDB Entry: 5tl7 (more details), 2.44 Å

PDB Description: crystal structure of sars-cov papain-like protease in complex with c- terminal domain mouse isg15
PDB Compounds: (D:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d5tl7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tl7d1 d.15.1.0 (D:4-62) automated matches {SARS coronavirus [TaxId: 227859]}
ktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlpsd

SCOPe Domain Coordinates for d5tl7d1:

Click to download the PDB-style file with coordinates for d5tl7d1.
(The format of our PDB-style files is described here.)

Timeline for d5tl7d1: