Lineage for d1ba1_1 (1ba1 4-188)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316624Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 316625Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 316626Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 316697Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 316698Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)
  8. 316703Domain d1ba1_1: 1ba1 4-188 [33387]

Details for d1ba1_1

PDB Entry: 1ba1 (more details), 1.7 Å

PDB Description: heat-shock cognate 70kd protein 44kd atpase n-terminal mutant with cys 17 replaced by lys

SCOP Domain Sequences for d1ba1_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ba1_1 c.55.1.1 (4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
gpavgidlgttyskvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk

SCOP Domain Coordinates for d1ba1_1:

Click to download the PDB-style file with coordinates for d1ba1_1.
(The format of our PDB-style files is described here.)

Timeline for d1ba1_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ba1_2