SCOP 1.67: Domain d1ba1_1: 1ba1 4-188

Lineage for d1ba1_1 (1ba1 4-188)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)

8. Domain d1ba1_1: 1ba1 4-188 [33387]

Details for d1ba1_1

PDB Entry: 1ba1, 1.7 Å

PDB Description: heat-shock cognate 70kd protein 44kd atpase n-terminal mutant with cys 17 replaced by lys

SCOP Domain Sequences for d1ba1_1:

Sequence; same for both SEQRES and ATOM records:

>d1ba1_1 c.55.1.1 (4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
gpavgidlgttyskvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk

Timeline for d1ba1_1:

• d1ba1_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ba1_1 appears in SCOP 1.65
  
• d1ba1_1 appears in SCOP 1.69
  
• d1ba1_1 appears in the current release, SCOPe 2.08, called d1ba1a1