| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) | 
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest  | 
Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) ![]() duplication contains two domains of this fold  | 
| Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) | 
| Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) | 
| Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries) | 
| Domain d1ba1_2: 1ba1 189-381 [33388] complexed with adp, cl, mg, na; mutant  | 
PDB Entry: 1ba1 (more details), 1.7 Å
SCOP Domain Sequences for d1ba1_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ba1_2 c.55.1.1 (189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails
Timeline for d1ba1_2: