Lineage for d1ekjc_ (1ekj C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490902Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2490967Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2490968Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 2490969Protein beta-carbonic anhydrase [53058] (4 species)
  7. 2490986Species Pea (Pisum sativum) [TaxId:3888] [53059] (1 PDB entry)
  8. 2490989Domain d1ekjc_: 1ekj C: [33366]
    complexed with act, azi, cit, cl, cu, edo, zn

Details for d1ekjc_

PDB Entry: 1ekj (more details), 1.93 Å

PDB Description: the x-ray crystallographic structure of beta carbonic anhydrase from the c3 dicot pisum sativum
PDB Compounds: (C:) beta-carbonic anhydrase

SCOPe Domain Sequences for d1ekjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekjc_ c.53.2.1 (C:) beta-carbonic anhydrase {Pea (Pisum sativum) [TaxId: 3888]}
sdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvld
fqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsf
pfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvr
eglvnktlalkggyydfvkgsfelwglefglsstfsv

SCOPe Domain Coordinates for d1ekjc_:

Click to download the PDB-style file with coordinates for d1ekjc_.
(The format of our PDB-style files is described here.)

Timeline for d1ekjc_: