![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
![]() | Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) ![]() |
![]() | Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins) |
![]() | Protein beta-carbonic anhydrase [53058] (4 species) |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [53059] (1 PDB entry) |
![]() | Domain d1ekjb_: 1ekj B: [33365] complexed with act, azi, cit, cl, cu, edo, zn |
PDB Entry: 1ekj (more details), 1.93 Å
SCOPe Domain Sequences for d1ekjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ekjb_ c.53.2.1 (B:) beta-carbonic anhydrase {Pea (Pisum sativum) [TaxId: 3888]} pkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpg eafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdg tystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglv nktlalkggyydfvkgsfelwglefglsstfsv
Timeline for d1ekjb_: