SCOPe 2.06: Domain d1exna2: 1exn A:20-185

Lineage for d1exna2 (1exn A:20-185)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein T5 5'-exonuclease [53050] (1 species)

7. Species Bacteriophage T5 [TaxId:10726] [53051] (6 PDB entries)

8. Domain d1exna2: 1exn A:20-185 [33358]
   Other proteins in same PDB: d1exna1, d1exnb1

Details for d1exna2

PDB Entry: 1exn, 2.5 Å

PDB Description: t5 5'-exonuclease

PDB Compounds: (A:) 5'-exonuclease

SCOPe Domain Sequences for d1exna2:

Sequence; same for both SEQRES and ATOM records:

>d1exna2 c.120.1.2 (A:20-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhn

Timeline for d1exna2:

• d1exna2 first appeared (with stable ids) in SCOP 1.55
  
• d1exna2 appears in SCOPe 2.05
  
• d1exna2 appears in SCOPe 2.07
  
• d1exna2 appears in the current release, SCOPe 2.08