SCOPe 2.06: Domain d1exna1: 1exn A:186-290

Lineage for d1exna1 (1exn A:186-290)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein T5 5'-exonuclease [47813] (1 species)

7. Species Bacteriophage T5 [TaxId:10726] [47814] (6 PDB entries)

8. Domain d1exna1: 1exn A:186-290 [18088]
   Other proteins in same PDB: d1exna2, d1exnb2

Details for d1exna1

PDB Entry: 1exn, 2.5 Å

PDB Description: t5 5'-exonuclease

PDB Compounds: (A:) 5'-exonuclease

SCOPe Domain Sequences for d1exna1:

Sequence; same for both SEQRES and ATOM records:

>d1exna1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiae

Timeline for d1exna1:

• d1exna1 first appeared (with stable ids) in SCOP 1.55
  
• d1exna1 appears in SCOPe 2.05
  
• d1exna1 appears in SCOPe 2.07
  
• d1exna1 appears in the current release, SCOPe 2.08