Lineage for d1xo1b2 (1xo1 B:19-185)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245914Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 245915Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
  5. 245927Family c.53.1.2: 5' to 3' exonuclease [53045] (4 proteins)
    contains additional strand and alpha-helical arch; strand order 321456; strand 6 is antiparallel to the rest
  6. 245947Protein T5 5'-exonuclease [53050] (1 species)
  7. 245948Species Bacteriophage T5 [TaxId:10726] [53051] (2 PDB entries)
  8. 245950Domain d1xo1b2: 1xo1 B:19-185 [33357]
    Other proteins in same PDB: d1xo1a1, d1xo1b1
    mutant

Details for d1xo1b2

PDB Entry: 1xo1 (more details), 2.5 Å

PDB Description: t5 5'-exonuclease mutant k83a

SCOP Domain Sequences for d1xo1b2:

Sequence, based on SEQRES records: (download)

>d1xo1b2 c.53.1.2 (B:19-185) T5 5'-exonuclease {Bacteriophage T5}
rrnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrleh
lpeyagnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivk
lighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhn

Sequence, based on observed residues (ATOM records): (download)

>d1xo1b2 c.53.1.2 (B:19-185) T5 5'-exonuclease {Bacteriophage T5}
rrnlmivdgtnlgfrfpfassyvstiqslaksysarttivlgdkgksvfrlehlpeyaff
eylkdafelckttfptftirgveaddmaayivklighlydhvwlistdgdwdtlltdkvs
rfsfttrreyhlrdmyehhn

SCOP Domain Coordinates for d1xo1b2:

Click to download the PDB-style file with coordinates for d1xo1b2.
(The format of our PDB-style files is described here.)

Timeline for d1xo1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xo1b1