SCOP 1.63: Domain d1xo1a1: 1xo1 A:186-290

Lineage for d1xo1a1 (1xo1 A:186-290)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (1 family)

5. Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins)

6. Protein T5 5'-exonuclease [47813] (1 species)

7. Species Bacteriophage T5 [TaxId:10726] [47814] (2 PDB entries)

8. Domain d1xo1a1: 1xo1 A:186-290 [18086]
   Other proteins in same PDB: d1xo1a2, d1xo1b2

Details for d1xo1a1

PDB Entry: 1xo1, 2.5 Å

PDB Description: t5 5'-exonuclease mutant k83a

SCOP Domain Sequences for d1xo1a1:

Sequence; same for both SEQRES and ATOM records:

>d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5}
vddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqn
lnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiae

Timeline for d1xo1a1:

• d1xo1a1 first appeared (with stable ids) in SCOP 1.55
  
• d1xo1a1 appears in SCOP 1.61
  
• d1xo1a1 appears in SCOP 1.65
  
• d1xo1a1 appears in the current release, SCOPe 2.08