Lineage for d5lajx_ (5laj X:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2990995Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2993054Domain d5lajx_: 5laj X: [333444]
    Other proteins in same PDB: d5lajb_, d5lajc1, d5lajc2, d5lajd_, d5laje_, d5lajf_, d5lajg_, d5lajh_, d5lajm_, d5lajp_, d5lajq1, d5lajq2, d5lajr_, d5lajs_, d5lajt_, d5laju_, d5lajv_
    automated match to d1rypk_
    complexed with mg

Details for d5lajx_

PDB Entry: 5laj (more details), 2.9 Å

PDB Description: ligand-induced lys33-thr1 crosslinking at the yeast proteasomal subunit beta5 by sulfonate esters
PDB Compounds: (X:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d5lajx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lajx_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

SCOPe Domain Coordinates for d5lajx_:

Click to download the PDB-style file with coordinates for d5lajx_.
(The format of our PDB-style files is described here.)

Timeline for d5lajx_: