Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (33 species) not a true protein |
Species Fusobacterium nucleatum [TaxId:190304] [333378] (2 PDB entries) |
Domain d5b53a_: 5b53 A: [333381] automated match to d5d86a_ complexed with cl, plp |
PDB Entry: 5b53 (more details), 2.91 Å
SCOPe Domain Sequences for d5b53a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b53a_ c.79.1.0 (A:) automated matches {Fusobacterium nucleatum [TaxId: 190304]} eqkkmkylenlvgktpmlelifdykgeerrifvknesynltgsikdrmafytlkkayekn eikkgapiveatsgntgiafsamgailghpviiympdwmseerkslirsfgakiilvsrk eggflgsiektkefaknnpdtylpsqfsnlynseahyygigleivnemkslnlnidgfva gvgtggtvmgigkrikenfsnakicpleplnsptlstgykvakhriegisdefipdlvkl dkldnvvsvddgdaivmaqklakcglgvgissganfigalmlqnklgkdsvivtvfpddn kkylstdlmreekvkedflskditlkeiknvlrv
Timeline for d5b53a_: