Lineage for d1fzrc_ (1fzr C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 994432Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 994433Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 994628Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein)
  6. 994629Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)
    forms dimer by swapping the common core elements
  7. 994630Species Bacteriophage T7 [TaxId:10760] [53031] (3 PDB entries)
  8. 994637Domain d1fzrc_: 1fzr C: [33338]
    CASP4

Details for d1fzrc_

PDB Entry: 1fzr (more details), 2.1 Å

PDB Description: crystal structure of bacteriophage t7 endonuclease i
PDB Compounds: (C:) endonuclease I

SCOPe Domain Sequences for d1fzrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzrc_ c.52.1.17 (C:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7 [TaxId: 10760]}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvktkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

SCOPe Domain Coordinates for d1fzrc_:

Click to download the PDB-style file with coordinates for d1fzrc_.
(The format of our PDB-style files is described here.)

Timeline for d1fzrc_: