SCOP 1.61: Domain d1fzrc_: 1fzr C:

Lineage for d1fzrc_ (1fzr C:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (19 families)

5. Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (1 protein)

6. Protein Endonuclease I (Holliday junction resolvase) [53030] (1 species)

7. Species Bacteriophage T7 [TaxId:10760] [53031] (2 PDB entries)

8. Domain d1fzrc_: 1fzr C: [33338]

Details for d1fzrc_

PDB Entry: 1fzr, 2.1 Å

PDB Description: crystal structure of bacteriophage t7 endonuclease i

SCOP Domain Sequences for d1fzrc_:

Sequence; same for both SEQRES and ATOM records:

>d1fzrc_ c.52.1.17 (C:) Endonuclease I (Holliday junction resolvase) {Bacteriophage T7}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvktkglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

Timeline for d1fzrc_:

• d1fzrc_ first appeared (with stable ids) in SCOP 1.55
  
• d1fzrc_ appears in SCOP 1.59
  
• d1fzrc_ appears in SCOP 1.63
  
• d1fzrc_ appears in the current release, SCOPe 2.08