Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) |
Family c.52.1.16: TnsA endonuclease, N-terminal domain [53026] (1 protein) |
Protein TnsA endonuclease, N-terminal domain [53027] (1 species) a catalytic component of the tn7 transposition system |
Species Escherichia coli [TaxId:562] [53028] (2 PDB entries) Uniprot P13988 |
Domain d1f1zb2: 1f1z B:8-168 [33335] Other proteins in same PDB: d1f1za1, d1f1zb1 complexed with cl, mg |
PDB Entry: 1f1z (more details), 2.4 Å
SCOPe Domain Sequences for d1f1zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1zb2 c.52.1.16 (B:8-168) TnsA endonuclease, N-terminal domain {Escherichia coli [TaxId: 562]} fsevqiarrikegrgqghgkdyipwltvqevpssgrshriyshktgrvhhllsdlelavf lslewessvldireqfpllpsdtrqiaidsgikhpvirgvdqvmstdflvdckdgpfeqf aiqvkpaaalqdertleklelerrywqqkqipwfiftdkei
Timeline for d1f1zb2: