Lineage for d1f1zb2 (1f1z B:8-168)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24772Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
  4. 24773Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) (S)
  5. 24924Family c.52.1.16: TnsA endonuclease, N-terminal domain [53026] (1 protein)
  6. 24925Protein TnsA endonuclease, N-terminal domain [53027] (1 species)
  7. 24926Species Escherichia coli [TaxId:562] [53028] (1 PDB entry)
  8. 24928Domain d1f1zb2: 1f1z B:8-168 [33335]
    Other proteins in same PDB: d1f1za1, d1f1zb1

Details for d1f1zb2

PDB Entry: 1f1z (more details), 2.4 Å

PDB Description: tnsa, a catalytic component of the tn7 transposition system

SCOP Domain Sequences for d1f1zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1zb2 c.52.1.16 (B:8-168) TnsA endonuclease, N-terminal domain {Escherichia coli}
fsevqiarrikegrgqghgkdyipwltvqevpssgrshriyshktgrvhhllsdlelavf
lslewessvldireqfpllpsdtrqiaidsgikhpvirgvdqvmstdflvdckdgpfeqf
aiqvkpaaalqdertleklelerrywqqkqipwfiftdkei

SCOP Domain Coordinates for d1f1zb2:

Click to download the PDB-style file with coordinates for d1f1zb2.
(The format of our PDB-style files is described here.)

Timeline for d1f1zb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f1zb1