SCOPe 2.06: Domain d5xbpa2: 5xbp A:153-445

Lineage for d5xbpa2 (5xbp A:153-445)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein automated matches [319939] (1 species)
   not a true protein

7. Species Diaphorobacter sp. [TaxId:1302548] [319940] (2 PDB entries)

8. Domain d5xbpa2: 5xbp A:153-445 [333331]
   Other proteins in same PDB: d5xbpa1, d5xbpc_, d5xbpd1, d5xbpf_, d5xbpg1, d5xbpi_
   automated match to d1eg9a2
   complexed with fe, fes

Details for d5xbpa2

PDB Entry: 5xbp, 2.9 Å

PDB Description: oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2

PDB Compounds: (A:) 3NT oxygenase alpha subunit

SCOPe Domain Sequences for d5xbpa2:

Sequence; same for both SEQRES and ATOM records:

>d5xbpa2 d.129.3.3 (A:153-445) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
eapplidylgdaawymeptfkhsgglelvgppgkvvvkanwktfaenfvgdiyhvgwtha
silrvgqsvftplagnamlppegsglqmtskygsgmslmwdyyagnhsadlvpdlmafgg
akqeklakeigdvrariyrshlngtifpnnsfltgsaafkvwnpidenttevwtyafvek
dmpedlkrrladavqrtvgpggywesddndnmetlsqnakkyqssnsdliaslgfgkdvy
gdecypgvvgpsgasetsyrgfyrayqahisssnwaefenasrnwhteltktt

Timeline for d5xbpa2:

• d5xbpa2 is new in SCOPe 2.06-stable
  
• d5xbpa2 appears in SCOPe 2.07
  
• d5xbpa2 appears in the current release, SCOPe 2.08