Lineage for d5xbpa1 (5xbp A:2-152)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053226Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2053227Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2053448Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2053449Protein automated matches [190701] (11 species)
    not a true protein
  7. 2053535Species Diaphorobacter sp. [TaxId:1302548] [319937] (3 PDB entries)
  8. 2053537Domain d5xbpa1: 5xbp A:2-152 [333330]
    Other proteins in same PDB: d5xbpa2, d5xbpc_, d5xbpd2, d5xbpf_, d5xbpg2, d5xbpi_
    automated match to d1o7na1
    complexed with fe, fes

Details for d5xbpa1

PDB Entry: 5xbp (more details), 2.9 Å

PDB Description: oxygenase component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2
PDB Compounds: (A:) 3NT oxygenase alpha subunit

SCOPe Domain Sequences for d5xbpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xbpa1 b.33.1.0 (A:2-152) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
syqnlvseagltqkhlihgdkelfqhemktifarnwlflthdslipspgdyvtakmglde
vivsrqndgsvraflnvcrhrgktivhaeagnakgfvcnyhgwgygtngelqsvpfekel
ygdaikkkclglkevpriesfhgfiygcfda

SCOPe Domain Coordinates for d5xbpa1:

Click to download the PDB-style file with coordinates for d5xbpa1.
(The format of our PDB-style files is described here.)

Timeline for d5xbpa1: