Lineage for d1cw0a_ (1cw0 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136225Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2136226Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2136431Family c.52.1.15: Very short patch repair (VSR) endonuclease [53023] (1 protein)
  6. 2136432Protein Very short patch repair (VSR) endonuclease [53024] (1 species)
  7. 2136433Species Escherichia coli [TaxId:562] [53025] (3 PDB entries)
  8. 2136435Domain d1cw0a_: 1cw0 A: [33333]
    protein/DNA complex; complexed with mg, zn

Details for d1cw0a_

PDB Entry: 1cw0 (more details), 2.3 Å

PDB Description: crystal structure analysis of very short patch repair (vsr) endonuclease in complex with a duplex dna
PDB Compounds: (A:) protein (DNA mismatch endonuclease)

SCOPe Domain Sequences for d1cw0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cw0a_ c.52.1.15 (A:) Very short patch repair (VSR) endonuclease {Escherichia coli [TaxId: 562]}
advhdkatrsknmraiatrdtaiekrlaslltgqglafrvqdaslpgrpdfvvdeyrcvi
fthgcfwhhhhcylfkvpatrtefwlekigknverdrrdisrlqelgwrvlivwecalrg
rekltdealterleewicgegasaqidtqgihlla

SCOPe Domain Coordinates for d1cw0a_:

Click to download the PDB-style file with coordinates for d1cw0a_.
(The format of our PDB-style files is described here.)

Timeline for d1cw0a_: