SCOPe 2.05: Domain d1cw0a_: 1cw0 A:

Lineage for d1cw0a_ (1cw0 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.15: Very short patch repair (VSR) endonuclease [53023] (1 protein)

6. Protein Very short patch repair (VSR) endonuclease [53024] (1 species)

7. Species Escherichia coli [TaxId:562] [53025] (3 PDB entries)

8. Domain d1cw0a_: 1cw0 A: [33333]
   protein/DNA complex; complexed with mg, zn

Details for d1cw0a_

PDB Entry: 1cw0, 2.3 Å

PDB Description: crystal structure analysis of very short patch repair (vsr) endonuclease in complex with a duplex dna

PDB Compounds: (A:) protein (DNA mismatch endonuclease)

SCOPe Domain Sequences for d1cw0a_:

Sequence; same for both SEQRES and ATOM records:

>d1cw0a_ c.52.1.15 (A:) Very short patch repair (VSR) endonuclease {Escherichia coli [TaxId: 562]}
advhdkatrsknmraiatrdtaiekrlaslltgqglafrvqdaslpgrpdfvvdeyrcvi
fthgcfwhhhhcylfkvpatrtefwlekigknverdrrdisrlqelgwrvlivwecalrg
rekltdealterleewicgegasaqidtqgihlla

Timeline for d1cw0a_:

• d1cw0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cw0a_ appears in SCOPe 2.04
  
• d1cw0a_ appears in SCOPe 2.06
  
• d1cw0a_ appears in the current release, SCOPe 2.08