Lineage for d5jb4c_ (5jb4 C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259419Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2259420Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2259689Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 2259690Protein automated matches [190829] (11 species)
    not a true protein
  7. 2259696Species Cow (Bos taurus) [TaxId:9913] [255754] (7 PDB entries)
  8. 2259713Domain d5jb4c_: 5jb4 C: [333232]
    automated match to d4wxvc_
    complexed with so4

Details for d5jb4c_

PDB Entry: 5jb4 (more details), 1.99 Å

PDB Description: a simplified bpti variant containing 21 alanines out 58 of residues
PDB Compounds: (C:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d5jb4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jb4c_ g.8.1.0 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpafcleppyagpgaaaiiryfynaaagaaqafvyggvrakrnnfasaadalaacaaa

SCOPe Domain Coordinates for d5jb4c_:

Click to download the PDB-style file with coordinates for d5jb4c_.
(The format of our PDB-style files is described here.)

Timeline for d5jb4c_: