PDB entry 5jb4

View 5jb4 on RCSB PDB site
Description: A simplified BPTI variant containing 21 alanines out 58 of residues
Class: hydrolase inhibitor
Keywords: Bovine pancreatic trypsin inhibitor variant, sequence simplification, 21 alanines, protein design, HYDROLASE INHIBITOR
Deposited on 2016-04-13, released 2017-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • variant (2)
      • variant (10)
      • engineered mutation (13)
      • variant (14)
      • variant (16)
      • variant (25)
      • variant (28-29)
      • variant (31)
      • engineered mutation (37)
      • variant (45)
      • variant (48)
      • variant (50)
      • engineered mutation (51)
      • variant (52-53)
      • variant (55-56)
    Domains in SCOPe 2.06: d5jb4a_
  • Chain 'B':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • variant (2)
      • variant (10)
      • engineered mutation (13)
      • variant (14)
      • variant (16)
      • variant (25)
      • variant (28-29)
      • variant (31)
      • engineered mutation (37)
      • variant (45)
      • variant (48)
      • variant (50)
      • engineered mutation (51)
      • variant (52-53)
      • variant (55-56)
    Domains in SCOPe 2.06: d5jb4b_
  • Chain 'C':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • variant (2)
      • variant (10)
      • engineered mutation (13)
      • variant (14)
      • variant (16)
      • variant (25)
      • variant (28-29)
      • variant (31)
      • engineered mutation (37)
      • variant (45)
      • variant (48)
      • variant (50)
      • engineered mutation (51)
      • variant (52-53)
      • variant (55-56)
    Domains in SCOPe 2.06: d5jb4c_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jb4A (A:)
rpafcleppyagpgaaaiiryfynaaagaaqafvyggvrakrnnfasaadalaacaaa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jb4B (B:)
rpafcleppyagpgaaaiiryfynaaagaaqafvyggvrakrnnfasaadalaacaaa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jb4C (C:)
rpafcleppyagpgaaaiiryfynaaagaaqafvyggvrakrnnfasaadalaacaaa