SCOPe 2.08: Domain d5szdl1: 5szd L:4-72

Lineage for d5szdl1 (5szd L:4-72)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (14 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [333224] (1 PDB entry)

8. Domain d5szdl1: 5szd L:4-72 [333225]
   Other proteins in same PDB: d5szda2, d5szdb2, d5szdc2, d5szdf2, d5szdg2, d5szdh2, d5szdi2, d5szdj2, d5szdk2, d5szdl2
   automated match to d3sb2a_
   complexed with cl, gai, mpd, mrd, peg

Details for d5szdl1

PDB Entry: 5szd, 1.49 Å

PDB Description: crystal structure of aquifex aeolicus hfq at 1.5a

PDB Compounds: (L:) RNA-binding protein Hfq

SCOPe Domain Sequences for d5szdl1:

Sequence; same for both SEQRES and ATOM records:

>d5szdl1 b.38.1.0 (L:4-72) automated matches {Aquifex aeolicus [TaxId: 224324]}
mpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhaitt
ivpherlei

Timeline for d5szdl1:

• d5szdl1 first appeared in SCOPe 2.06
  
• d5szdl1 appears in SCOPe 2.07