PDB entry 5szd

View 5szd on RCSB PDB site
Description: Crystal structure of Aquifex aeolicus Hfq at 1.5A
Class: RNA binding protein
Keywords: Hfq, Aquifex, RNA-binding, RNA BINDING PROTEIN
Deposited on 2016-08-13, released 2017-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66512 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5szda1, d5szda2
  • Chain 'B':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66512 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5szdb1, d5szdb2
  • Chain 'C':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66512 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5szdc1, d5szdc2
  • Chain 'D':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5szdd_
  • Chain 'E':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5szde_
  • Chain 'F':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66512 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5szdf1, d5szdf2
  • Chain 'G':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66512 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5szdg1, d5szdg2
  • Chain 'H':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66512 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5szdh1, d5szdh2
  • Chain 'I':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66512 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5szdi1, d5szdi2
  • Chain 'J':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66512 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5szdj1, d5szdj2
  • Chain 'K':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66512 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5szdk1, d5szdk2
  • Chain 'L':
    Compound: RNA-binding protein Hfq
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: hfq, aq_108, aq_108B
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66512 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5szdl1, d5szdl2
  • Heterogens: MRD, MPD, GAI, CL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5szdA (A:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdA (A:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherlei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5szdB (B:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdB (B:)
    hmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhait
    tivpherlei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5szdC (C:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdC (C:)
    shmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhai
    ttivpherlei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5szdD (D:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdD (D:)
    mpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhaitt
    ivpherlei
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5szdE (E:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdE (E:)
    mpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhaitt
    ivpherlei
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5szdF (F:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdF (F:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherlei
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5szdG (G:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdG (G:)
    shmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhai
    ttivpherle
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5szdH (H:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdH (H:)
    shmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhai
    ttivpherlei
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5szdI (I:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdI (I:)
    shmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhai
    ttivpherlei
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5szdJ (J:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdJ (J:)
    shmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhai
    ttivpherlei
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5szdK (K:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdK (K:)
    shmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhai
    ttivpherlei
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5szdL (L:)
    gshmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykha
    ittivpherleiefeeagvpgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5szdL (L:)
    shmpyklqesflntarkkrvkvsvylvngvrlqgrirsfdlftilledgkqqtlvykhai
    ttivpherlei