Lineage for d5juva5 (5juv A:846-1007)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384666Species Aspergillus niger [TaxId:425011] [333185] (6 PDB entries)
  8. 2384672Domain d5juva5: 5juv A:846-1007 [333208]
    Other proteins in same PDB: d5juva1, d5juva2, d5juva3, d5juva6
    automated match to d1tg7a3
    complexed with 1pe, bma, cl, gal, man, nag

Details for d5juva5

PDB Entry: 5juv (more details), 2.27 Å

PDB Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with 6-b-galactopyranosyl galactose
PDB Compounds: (A:) Probable beta-galactosidase A

SCOPe Domain Sequences for d5juva5:

Sequence; same for both SEQRES and ATOM records: (download)

>d5juva5 b.18.1.0 (A:846-1007) automated matches {Aspergillus niger [TaxId: 425011]}
edkvrgplnegglyaerqgfhqpeppsqnwkssspleglseagigfysasfdldlpkgwd
vplflnignsttpspyrvqvyvngyqyakyisnigpqtsfpvpegilnyrgtnwlavtlw
aldsaggkleslelsyttpvltalgevesvdqpkykkrkgay

SCOPe Domain Coordinates for d5juva5:

Click to download the PDB-style file with coordinates for d5juva5.
(The format of our PDB-style files is described here.)

Timeline for d5juva5: