![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Aspergillus niger [TaxId:425011] [333185] (6 PDB entries) |
![]() | Domain d5juva5: 5juv A:846-1007 [333208] Other proteins in same PDB: d5juva1, d5juva2, d5juva3, d5juva6 automated match to d1tg7a3 complexed with 1pe, cl, nag |
PDB Entry: 5juv (more details), 2.27 Å
SCOPe Domain Sequences for d5juva5:
Sequence; same for both SEQRES and ATOM records: (download)
>d5juva5 b.18.1.0 (A:846-1007) automated matches {Aspergillus niger [TaxId: 425011]} edkvrgplnegglyaerqgfhqpeppsqnwkssspleglseagigfysasfdldlpkgwd vplflnignsttpspyrvqvyvngyqyakyisnigpqtsfpvpegilnyrgtnwlavtlw aldsaggkleslelsyttpvltalgevesvdqpkykkrkgay
Timeline for d5juva5: