SCOPe 2.01: Domain d1fiud_: 1fiu D:

Lineage for d1fiud_ (1fiu D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families)

5. Family c.52.1.10: Restriction endonuclease NgoIV [53008] (1 protein)

6. Protein Restriction endonuclease NgoIV [53009] (1 species)

7. Species Neisseria gonorrhoeae [TaxId:485] [53010] (1 PDB entry)

8. Domain d1fiud_: 1fiu D: [33320]
   protein/DNA complex; complexed with acy, mg

Details for d1fiud_

PDB Entry: 1fiu, 1.6 Å

PDB Description: tetrameric restriction endonuclease ngomiv in complex with cleaved dna

PDB Compounds: (D:) type II restriction enzyme ngomi

SCOPe Domain Sequences for d1fiud_:

Sequence; same for both SEQRES and ATOM records:

>d1fiud_ c.52.1.10 (D:) Restriction endonuclease NgoIV {Neisseria gonorrhoeae [TaxId: 485]}
mqplftqerrifhkklldgnilatnnrgvvsnadgsntrsfniakgiadllhsetvserl
pgqtsgnafeaicsefvqsafeklqhirpgdwnvkqvgsrnrleiaryqqyahltalaka
aeenpelaaalgsdytitpdiivtrnliadaeinrneflvdeniatyaslragngnmpll
hasisckwtirsdraqnarseglnlvrnrkgrlphivvvtaeptpsrissialgtgeidc
vyhfalyeleqilqslnyedaldlfyimvngkrlkdisdlpldlav

Timeline for d1fiud_:

• d1fiud_ first appeared (with stable ids) in SCOP 1.55
  
• d1fiud_ appears in SCOP 1.75
  
• d1fiud_ appears in SCOPe 2.02
  
• d1fiud_ appears in the current release, SCOPe 2.08