SCOPe 2.06: Domain d5gxqf_: 5gxq F:

Lineage for d5gxqf_ (5gxq F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (57 PDB entries)

8. Domain d5gxqf_: 5gxq F: [333173]
   Other proteins in same PDB: d5gxqc_, d5gxqd_, d5gxqg_, d5gxqh_
   automated match to d1kx3f_
   protein/DNA complex

Details for d5gxqf_

PDB Entry: 5gxq, 2.85 Å

PDB Description: the crystal structure of the nucleosome containing h3.6

PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d5gxqf_:

Sequence; same for both SEQRES and ATOM records:

>d5gxqf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
ktvtamdvvyalkrqgrtlygfgg

Timeline for d5gxqf_:

• d5gxqf_ is new in SCOPe 2.06-stable
  
• d5gxqf_ appears in SCOPe 2.07
  
• d5gxqf_ appears in the current release, SCOPe 2.08