Lineage for d5vevb2 (5vev B:102-325)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585592Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2585593Protein automated matches [226904] (38 species)
    not a true protein
  7. 2585704Species Neisseria gonorrhoeae [TaxId:521006] [333085] (1 PDB entry)
  8. 2585706Domain d5vevb2: 5vev B:102-325 [333116]
    Other proteins in same PDB: d5veva1, d5veva3, d5veva4, d5vevb1, d5vevb3, d5vevb4
    automated match to d1gsoa3
    complexed with act, edo, na, so4

Details for d5vevb2

PDB Entry: 5vev (more details), 1.9 Å

PDB Description: crystal structure of phosphoribosylamine-glycine ligase from neisseria gonorrhoeae
PDB Compounds: (B:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d5vevb2:

Sequence, based on SEQRES records: (download)

>d5vevb2 d.142.1.0 (B:102-325) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
skdfakafmvkyniptaqyqtfenadaahdyvnqkgapivikadglvagkgvivamtlde
ahaaiddmllgnkmgnagervviedflqgeeasfivmvdgnhvlpmatsqdhkrlldgdk
gpntggmgayspapvvtpavyeramneiilptvagmkaegheftgflyaglmidqsgapy
tiefncrfgdpetqpimsrlnsdladlveaaidgrldsvkaewn

Sequence, based on observed residues (ATOM records): (download)

>d5vevb2 d.142.1.0 (B:102-325) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
skdfakafmvkyniptaqyqtfenadaahdyvnqkgapivikavivamtldeahaaiddm
lervviedflqgeeasfivmvdgnhvlpmatsqdhkrlldgdkgpntggmgayspapvvt
pavyeramneiilptvagmkaegheftgflyaglmidqsgapytiefncrfgdpetqpim
srlnsdladlveaaidgrldsvkaewn

SCOPe Domain Coordinates for d5vevb2:

Click to download the PDB-style file with coordinates for d5vevb2.
(The format of our PDB-style files is described here.)

Timeline for d5vevb2: