SCOPe 2.07: Domain d5vevb2: 5vev B:102-325

Lineage for d5vevb2 (5vev B:102-325)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (38 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:521006] [333085] (1 PDB entry)

8. Domain d5vevb2: 5vev B:102-325 [333116]
   Other proteins in same PDB: d5veva1, d5veva3, d5veva4, d5vevb1, d5vevb3, d5vevb4
   automated match to d1gsoa3
   complexed with act, edo, na, so4

Details for d5vevb2

PDB Entry: 5vev, 1.9 Å

PDB Description: crystal structure of phosphoribosylamine-glycine ligase from neisseria gonorrhoeae

PDB Compounds: (B:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d5vevb2:

Sequence, based on SEQRES records:

>d5vevb2 d.142.1.0 (B:102-325) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
skdfakafmvkyniptaqyqtfenadaahdyvnqkgapivikadglvagkgvivamtlde
ahaaiddmllgnkmgnagervviedflqgeeasfivmvdgnhvlpmatsqdhkrlldgdk
gpntggmgayspapvvtpavyeramneiilptvagmkaegheftgflyaglmidqsgapy
tiefncrfgdpetqpimsrlnsdladlveaaidgrldsvkaewn

Sequence, based on observed residues (ATOM records):

>d5vevb2 d.142.1.0 (B:102-325) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
skdfakafmvkyniptaqyqtfenadaahdyvnqkgapivikavivamtldeahaaiddm
lervviedflqgeeasfivmvdgnhvlpmatsqdhkrlldgdkgpntggmgayspapvvt
pavyeramneiilptvagmkaegheftgflyaglmidqsgapytiefncrfgdpetqpim
srlnsdladlveaaidgrldsvkaewn

Timeline for d5vevb2:

• d5vevb2 first appeared in SCOPe 2.06
  
• d5vevb2 appears in the current release, SCOPe 2.08