Lineage for d5veva1 (5vev A:1-101)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470709Species Neisseria gonorrhoeae [TaxId:521006] [333083] (1 PDB entry)
  8. 2470710Domain d5veva1: 5vev A:1-101 [333084]
    Other proteins in same PDB: d5veva2, d5veva3, d5veva4, d5vevb2, d5vevb3, d5vevb4
    automated match to d1gsoa2
    complexed with act, edo, na, so4

Details for d5veva1

PDB Entry: 5vev (more details), 1.9 Å

PDB Description: crystal structure of phosphoribosylamine-glycine ligase from neisseria gonorrhoeae
PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d5veva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5veva1 c.30.1.0 (A:1-101) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
mkllvignggrehalawklaqspkvetvfvapgnagtaiesklqnialtayqdliefcrk
enivftvvgpeaplaagivddfraaglkifgptqyaaqles

SCOPe Domain Coordinates for d5veva1:

Click to download the PDB-style file with coordinates for d5veva1.
(The format of our PDB-style files is described here.)

Timeline for d5veva1: