| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (39 species) not a true protein |
| Species Neisseria gonorrhoeae [TaxId:521006] [333083] (1 PDB entry) |
| Domain d5veva1: 5vev A:1-101 [333084] Other proteins in same PDB: d5veva2, d5veva3, d5veva4, d5vevb2, d5vevb3, d5vevb4 automated match to d1gsoa2 complexed with act, edo, na, so4 |
PDB Entry: 5vev (more details), 1.9 Å
SCOPe Domain Sequences for d5veva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5veva1 c.30.1.0 (A:1-101) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
mkllvignggrehalawklaqspkvetvfvapgnagtaiesklqnialtayqdliefcrk
enivftvvgpeaplaagivddfraaglkifgptqyaaqles
Timeline for d5veva1:
View in 3DDomains from other chains: (mouse over for more information) d5vevb1, d5vevb2, d5vevb3, d5vevb4 |