Lineage for d1pvia_ (1pvi A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170597Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1170598Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1170700Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein)
  6. 1170701Protein Restriction endonuclease PvuII [52997] (1 species)
  7. 1170702Species Proteus vulgaris [TaxId:585] [52998] (9 PDB entries)
  8. 1170715Domain d1pvia_: 1pvi A: [33310]
    protein/DNA complex

Details for d1pvia_

PDB Entry: 1pvi (more details), 2.6 Å

PDB Description: structure of pvuii endonuclease with cognate dna
PDB Compounds: (A:) protein (pvuii (e.c.3.1.21.4))

SCOPe Domain Sequences for d1pvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvia_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris [TaxId: 585]}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy

SCOPe Domain Coordinates for d1pvia_:

Click to download the PDB-style file with coordinates for d1pvia_.
(The format of our PDB-style files is described here.)

Timeline for d1pvia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pvib_