Lineage for d1pvia_ (1pvi A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) Superfamily c.52.1: Restriction endonuclease-like [52980] (17 families) 
Family c.52.1.6: Restriction endonuclease PvuII [52996] (1 protein) Protein Restriction endonuclease PvuII [52997] (1 species) Species Proteus vulgaris [TaxId:585] [52998] (6 PDB entries) 
Domain d1pvia_: 1pvi A: [33310]
Details for d1pvia_
PDB Entry: 1pvi (more details), 2.8 Å
PDB Description: structure of pvuii endonuclease with cognate dna
SCOP Domain Sequences for d1pvia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvia_ c.52.1.6 (A:) Restriction endonuclease PvuII {Proteus vulgaris}
shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
SCOP Domain Coordinates for d1pvia_:
Click to download the PDB-style file with coordinates for d1pvia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pvia_:
- d1pvia_ appears in SCOP 1.57
- d1pvia_ appears in the current release, SCOPe 2.08
View in 3D
